PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c7_5800V3.1.p
Common NameGlk1, PHYPADRAFT_61021
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family G2-like
Protein Properties Length: 512aa    MW: 55482.2 Da    PI: 5.1459
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c7_5800V3.1.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like86.42.8e-27222276156
           G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                       k++++WtpeLH+rFv+aveqL G ekA P++ilelm+v++Lt+++++SHLQkYR++
  Pp3c7_5800V3.1.p 222 KAKVDWTPELHRRFVHAVEQL-GVEKAFPSRILELMGVQCLTRHNIASHLQKYRSH 276
                       6799*****************.********************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.533219278IPR017930Myb domain
SuperFamilySSF466891.02E-17220278IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.4E-27220279IPR009057Homeodomain-like
TIGRFAMsTIGR015578.3E-25222276IPR006447Myb domain, plants
PfamPF002491.6E-7225274IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010638Biological Processpositive regulation of organelle organization
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000006anatomyplant protoplast
PO:0030003anatomyprotonema
PO:0030018anatomygametophore
Sequence ? help Back to Top
Protein Sequence    Length: 512 aa     Download sequence    Send to blast
MAMDMARIEV EPLVEVHNNT NNLLVHCVLD ALPDSSPCLK SSETSFEAVV VKEDEEGGRP  60
LFGKPELHPA SPSSDTAAAA NGEFARCLNF VTEADCGDVG VQCFEDFGTL PDCGEAGISR  120
EEGGGRDGEQ VELLESMSLD GSRNSENLEL GELGELLQGS ETLDSVPGNE VGEEEALLLA  180
KAAKATGVVV SASDSGECSS VDRKENQQSP KSCKSAAPGK KKAKVDWTPE LHRRFVHAVE  240
QLGVEKAFPS RILELMGVQC LTRHNIASHL QKYRSHRRHL AAREAEAASW THRRAYTQMP  300
WSRSSRRDGL PYLVPLHTPH IQPRPSMVMA MQPQLQTQHT PVSTPLKVWG YPTVDHSSVH  360
MWQQPAVATP SYWQAPDGSY WQHPATNYDA YSARACYPHP MRVSLGTTHA GSPMMAPGFP  420
DESYYGEDVL AATMYLCNQS YDSELGRAAG VAACSKPPET HLSKEVLDAA IGEALANPWT  480
PPPLGLKPPS MEGVIAELQR QGINTVPPST C*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A5e-16219274257ARR10-B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY7416840.0AY741684.1 Physcomitrella patens golden 2-like protein 1 (Glk1) gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_001781777.10.0predicted protein
TrEMBLQ5IFL70.0Q5IFL7_PHYPA; Golden 2-like protein 1
STRINGPP1S311_30V6.10.0(Physcomitrella patens)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP28401529
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G20570.13e-40GBF's pro-rich region-interacting factor 1
Publications ? help Back to Top
  1. Yasumura Y,Moylan EC,Langdale JA
    A conserved transcription factor mediates nuclear control of organelle biogenesis in anciently diverged land plants.
    Plant Cell, 2005. 17(7): p. 1894-907
    [PMID:15923345]
  2. Rensing SA, et al.
    The Physcomitrella genome reveals evolutionary insights into the conquest of land by plants.
    Science, 2008. 319(5859): p. 64-9
    [PMID:18079367]